Search: Puzzle
20 result(s) on page 1
puzzle
Indexed by skills.sh from gamedev-skills/awesome-gamedev-agent-skills
quarantinedskills.sh- Registry
- skills.sh
- Category
- Gaming· inferred
- Version
- 1.0.0
- Author
- gamedev-skills
curl -s /v1/skills/community__axehub:skills.sh__skills.sh__puzzlelateral-thinking-puzzle
A turtle soup host needs to provide the scenario, the complete story (truth of the event), and the key point (the condition for guessing correctly).
quarantinedTurtle SoupReasoningInteractionLobeHub- Registry
- LobeHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:LobeHub__LobeHub__lateral-thinking-puzzleJane_Street_Puzzle_Archivist
Use when solving, organizing, or reviewing Jane Street monthly puzzles, especially when bootstrapping a new puzzle month, comparing against prior public solu...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Jane_Street_Puzzle_ArchivistAgentPuzzles.com
Competitive puzzle arena for AI agents with timed solving, per-model leaderboards, and 5 categories (reverse captcha, geolocation, logic, science, code). Use...
quarantinedagentsbenchmarkingbenchmarksClawHub- Registry
- ClawHub
- Category
- AI Agents
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__AgentPuzzles.comPuzzleTide_Agent_Evals
Use this skill when the user wants verifiable reasoning tasks to benchmark or test an LLM or agent — reproducible puzzle task sets (sudoku, word search) with...
quarantinedClawHub- Registry
- ClawHub
- Category
- Autonomous Ai Agents· inferred
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__PuzzleTide_Agent_EvalsPuzzleTide_Crossword
Use this skill whenever the user asks for a crossword puzzle — custom word/clue lists, themed crosswords, educational worksheets, or printable PDFs. Generate...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__PuzzleTide_CrosswordPuzzleTide_Printable_Puzzles
Use this skill when the user wants printable puzzle worksheets — PDF activity sheets for classrooms, kids, parties, newsletters, or activity books. Produces...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__PuzzleTide_Printable_PuzzlesPuzzleTide_Word_Search
Use this skill whenever the user asks for a word search puzzle — themed, custom word lists, kids activities, classroom worksheets, printable PDFs, or puzzle...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__PuzzleTide_Word_SearchPuzzleTide_Sudoku
Use this skill whenever the user asks to generate, solve, or check a sudoku — printable sudoku sheets, daily puzzles, difficulty-graded puzzles, or verifying...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__PuzzleTide_Sudokudetective-game-assistant
Play a game based on a given murder case
quarantineddetectivegamereasoningLobeHub- Registry
- LobeHub
- Category
- Gaming
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:LobeHub__LobeHub__detective-game-assistantdetective-novelist
Specializes in creating murder mystery stories with red herrings
quarantinedDetectiveGameReasoningLobeHubplay-wikigame
Play a live round of The Wiki Game: plan a short Wikipedia link-path from the round's Start article to its Goal with the Wikipedia API, then click through it in the browser within the 120s clock, returning the winning path, clicks, and score.
quarantinedgameswikipediapathfindingbrowse.sh- Registry
- browse.sh
- Category
- Games
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:browse.sh__browse.sh__play-wikigameBotcoin
A puzzle game for AI agents. Register, solve investigative research puzzles to earn coins, trade shares, and withdraw $BOTFARM tokens on Base.
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__BotcoinGame_Design_Failure_Loop_Audit
Audit a game, feature, encounter structure, roguelite run, puzzle sequence, onboarding path, or progression gate through the lens of its failure loop: what h...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Game_Design_Failure_Loop_AuditGame_Design_Thinking_Fast_and_Slow_Audit
Audit a game, feature, combat system, economy loop, onboarding flow, puzzle, UI, or design proposal through the lens of fast versus slow thinking inspired by...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Game_Design_Thinking_Fast_and_Slow_AuditGame_Design_Zeigarnik_Effect_Audit
Audit a game, feature, task system, quest flow, event track, puzzle chain, progression layer, or return loop through the lens of the Zeigarnik effect: the te...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Game_Design_Zeigarnik_Effect_AuditGet_Today_Connections
Fetch today's NYT Connections puzzle answers and hints. Trigger this skill when the user asks for "today's Connections answers", "today's connections hints",...
quarantinedClawHub- Registry
- ClawHub
- Category
- Autonomous Ai Agents· inferred
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Get_Today_ConnectionsMarketing_Hooks
Create compelling marketing hooks and content structures using the Puzzle-Driven Model. Use when creating social media posts, newsletters, video scripts, or...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Marketing_HooksQuadral_Openclaw_Skill
Play Quadral - a word puzzle that benchmarks your reasoning against humans and other agents
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Quadral_Openclaw_SkillWord_Jumble
Generate a Word Jumble puzzle — scrambled words with circled letters that spell out a final idiom, plus a cartoon illustration hint and a printable puzzle im...
quarantinedClawHub- Registry
- ClawHub
- Version
- 1.0.0
curl -s /v1/skills/community__axehub:ClawHub__ClawHub__Word_Jumble